• Log in with Facebook Log in with Twitter Log In with Google      Sign In    
  • Create Account
  LongeCity
              Advocacy & Research for Unlimited Lifespans

Photo
* * * * * 17 votes

Astragalus, Astragaloside IV


  • This topic is locked This topic is locked
2189 replies to this topic

#511 newshadow

  • Guest
  • 28 posts
  • 0 ₮

Posted 05 October 2009 - 11:23 PM

I've watched the first 59 minutes of the above video so far, and I've noticed that TA-65 does have one side effect: it causes memory difficulties. 100% of the speakers who've been taking it failed to remember a question for two minutes.



It may be a transient side effect of lowered blood glucose.

#512 newshadow

  • Guest
  • 28 posts
  • 0 ₮

Posted 05 October 2009 - 11:24 PM

I'm thinking of starting a resveratrol astragaloside combo, is it usefull to add in AC-11 for DNA repair?


I would add TMG,Folic acid,B-12 and NTBHA.

#513 newshadow

  • Guest
  • 28 posts
  • 0 ₮

Posted 06 October 2009 - 12:39 AM

You mean the price of the Patton protocol? Because TA-65 is not sold by itself.

For folks looking for alternatives to the Patton protocol, here is what is available:

1- We can order telomere test through the canadian lab.
2- We can check all Biomarkers through Biophysical250.
3- We can buy Cycloastragenol by itself, or in combination with the two items above.

We have done a few things so far: Suddenly we have reduced the price while knowing what ingredient is being taken, and have gotten quite a bit more biomarkers covered to boot.

Most folks can't do all 3 in one shot, so instead of packaging it all and calling it the "Loera Protocol" for our package which includes telomere and biomarker testing, we are starting to develop the menu so that you can pick what you want right now. (Besides, I would prefer some other name for this full package instead of using my last name like Mr. Noel Patton has used to promote his package of tests. It's also possible to offer it at a discounted price in some way.)

The point is, that when you buy TA-65, it is expensive because you can't buy the supplements on their own. I personally have another view on this, and that is to offer a menu of items to help folks pick what they find important, and can afford at the time.

Anyone have a good name for our package of tests and supplements for folks that want to buy them all in one shot?
I have a few ideas I am considering at the moment.

Cheers
A


The ''Chromosome Kit''

sponsored ad

  • Advert

#514 bsm

  • Guest
  • 30 posts
  • -1 ₮

Posted 06 October 2009 - 05:28 AM

Thank you for inquiry with SpectraCell. I am disappointed by their lack of response. I guess they are not as legitimate as I thought they were.

This also is disappointing because we still do not have an accurate test to measure telomore shortening from year to year. Would it be possible to put out a public request for any University labs to help give a more accurate measurement?

#515 stephen_b

  • Guest
  • 1,755 posts
  • 247 ₮

Posted 06 October 2009 - 05:49 PM

I've also started to eat less "unhealthy" fat and more low GI-food. This in order to be able to eliminate the side effects of Orlistat.


You've lost a significant amount of weight between the two sample points, I noticed.

What kinds of fat are you labeling 'unhealthy'?

Edited by stephen_b, 06 October 2009 - 05:53 PM.


#516 GreenPower

  • Guest
  • 201 posts
  • 69 ₮
  • Location:Europe

Posted 06 October 2009 - 07:43 PM

I've also started to eat less "unhealthy" fat and more low GI-food. This in order to be able to eliminate the side effects of Orlistat.


You've lost a significant amount of weight between the two sample points, I noticed.

What kinds of fat are you labeling 'unhealthy'?


Yes, but I don't think AIV had anything to do with me loosing weight. After the first period I had actually gained one kilo. There are some other values I measured at home (among them "body fat" and "skeletal muscle") which are somewhat interesting. Although I was training equally little during both periods, the percentual values had actually started to move during the first period. Here are some specifics.

Before period 1 - Baseline

Weight: 103 kg
Body Fat: 33.3%
Skeletal Muscle: 30.6%

After period 1 - AIV 3x33mg only
Weight: 104 kg
Body Fat: 32%
Skeletal Muscle: 31.5%

After period 2 - AIV 1x100mg + Chitosan, Orlistat 3x120mg and Gingko Biloba 1x100mg
Weight: 96 kg
Body Fat: 29.7%
Skeletal Muscle: 32.5%


Without naming any specific brands, I switched from my regular butter, which contains a lot of saturated fats, to a brand which contains "an increased level of poly-unsaturated fatty acids". Whenever possible I've also tried to use olive oil or canola oil.

#517 stephen_b

  • Guest
  • 1,755 posts
  • 247 ₮

Posted 06 October 2009 - 08:03 PM

Without naming any specific brands, I switched from my regular butter, which contains a lot of saturated fats, to a brand which contains "an increased level of poly-unsaturated fatty acids". Whenever possible I've also tried to use olive oil or canola oil.

I do enjoy olive oil, but I have purposely increased saturated fats in my diet (mostly with animal fats, butter, and coconut oil) because I have concluded that it is good for me. You might want to look at the other side of the debate (here and here are good starting points).

#518 tintinet

  • Guest
  • 1,972 posts
  • 503 ₮
  • Location:ME

Posted 06 October 2009 - 08:03 PM

I have a dream that one day people will stop "loosing" weight.

#519 taurus

  • Guest
  • 3 posts
  • 0 ₮

Posted 06 October 2009 - 10:55 PM

I reviewed most of the T.A.Sciences Telomere Talk webinar video. I have a number of comments to make. To begin, none of the speakers look discernibly younger than their stated ages, or presumed ages. No before and after photos were presented, and the anecdotal evidence as a whole was ENTIRELY weak and unconvincing. One of the presenters Dr. Bill Andrews gave an interesting presentation about the science surrounding Telomeres, but failed to persuade when giving his anecdotal evidence. It was stated that he runs 50 -135 mile marathons, and that his placing in his age group went up. I'm certain that this happens to others that don't take TA-65, so that is really no evidence at all. He says that he's seen several age spots disappear, but where are the before and after photos? And provide details...i.e. approximately how big and dark they were, when did they 1st appear, etc.. Where is his before and after health checkup results? Is not this guy a scientist??? Can't TA Sciences come up with some clients that are willing to post their health checkup results???

Dr. Bill and others mention that at birth we have ~10K base pairs of telomeres and that cell senescence happens when telomere length reaches ~5K base pairs. However, there is only a ONE testimonial on their website regarding accomplishing what TA-65 is supposed to accomplish! i.e. lengthening telomeres! It was by Bob WasKom, and he wrote "My telomeres got longer by 100 base pairs at 3 months and an additional 100 base pairs at 6 months". That doesn't seem like much lengthening, and I'd want to know if the lab he used to test employs methods accurate enough to measure telomere lengthening conclusively? Prove that first!

As for Telomere lengthening via Telmerase activation in general, it seems unlikely that anyone so far is "reversing" their aging in a visible way through oral ingestion of AIV, or TA-65 (or cycloastragenol if that is indeed what TA-65 is). If anyone reading this thread has additional anecdotal evidence to share please do so (include photos, or health checkup results if you have them) . It would be quite impressive if indeed a strong set of anecdotal evidence was gathered to suggest that age spots were disappearing, skin was dramatically improving, hair was turning from gray back to some color, etc..

To conclude, it may be possible that AIV or cycloastragenol could have some age defying impact, but it would be nice if by sharing more information, all of us could start to narrow down to what seems likely versus unlikely (idea: maybe a list/poll). Toward that end, I applaud all here who are openly sharing their test results and experiences. I do not applaud T.A. Sciences.

Edited by taurus, 06 October 2009 - 11:04 PM.


#520 MikeO

  • Guest
  • 5 posts
  • 1 ₮

Posted 07 October 2009 - 03:17 AM

Here's a doctor who's taking TA-65 and who has published his test results.

I'm not a doctor, but from what I can see I'm not impressed. What do you folks think?:

http://www.rechargeb.../myresults.html

-- Mike

Edited by MikeO, 07 October 2009 - 03:20 AM.


#521 niner

  • Guest
  • 16,276 posts
  • 2,000 ₮
  • Location:Philadelphia

Posted 07 October 2009 - 03:47 AM

Here's a doctor who's taking TA-65 and who has published his test results.

I'm not a doctor, but from what I can see I'm not impressed. What do you folks think?:

http://www.rechargeb.../myresults.html

Is this guy selling TA-65 treatments? Has TA Sciences morphed into some sort of MLM scheme now? His results look a little shaky from the objective measurements, but he seems convinced that it helped him. Looks like he's selling it, though. It sounds to me like no one can measure telomere length accurately enough to show a real change over less than a multi-year timespan, at this point.

#522 MikeO

  • Guest
  • 5 posts
  • 1 ₮

Posted 07 October 2009 - 04:08 AM

Yes, he's selling it, in association with TA Sciences. I believe they have a few more physicians around the U.S. offering it now. That was mentioned in the recent TA Sciences video.

His site says this:

"Dr. Edward Park is one of only five physicians in the world offering TA-65. "

-- Mike

Edited by MikeO, 07 October 2009 - 04:15 AM.


#523 TheFountain

  • Guest
  • 5,367 posts
  • 259 ₮

Posted 07 October 2009 - 04:16 AM

Can someone provide a real scientific answer to why Astragalus supplementation wouldn't lead to cancer? Anthony said a couple of things in the thread specifically about this but it wasn't very scientific.

#524 tunt01

  • Guest
  • 2,308 posts
  • 414 ₮
  • Location:NW

Posted 07 October 2009 - 06:29 AM

Can someone provide a real scientific answer to why Astragalus supplementation wouldn't lead to cancer? Anthony said a couple of things in the thread specifically about this but it wasn't very scientific.


they cant. and neither can elizabeth blackburn, nobel prize or not.
  • Enjoying the show x 1

#525 Anthony_Loera

  • Life Member
  • 3,175 posts
  • 750 ₮
  • Location:Miami Florida

Posted 07 October 2009 - 01:06 PM

So what you are saying is folks should avoid Astragalus altogether, and that supplement companies not sell any astragalus supplements? True it would take 22 grams a day of astragulus, however I don't agree with this argument to avoid it.

I already mentioned that Telomerase is not an Oncogene, and that transient telomerase which is activated throughout your life merely by getting the sniffles (In CD8-T Cells for example have been observed to activate high telomerase in acute mono), will not lead to cancer. In another study, transient telomerase has been considered safe in tissue engineering and wound healing.

If you believe that any telomerase would cause an issue, then even sunlight exposure (Taylor et al, 1996; Ueda et al, 1997) and lifestyle improvements would be a cause for cancer: http://www.articlesb...ity-615582.html

Of course Calvin Harley gives a Q&A, and mentions "transient telomerase" as well regarding degenerative disease. http://www.pbs.org/s...103_harley.html

To wrap it up, I don't agree with the argument to avoid large amounts of astragalus supplements, A4 and Cycloastragenol extracts.


A

Edited by Anthony_Loera, 07 October 2009 - 02:01 PM.


#526 GreenPower

  • Guest
  • 201 posts
  • 69 ₮
  • Location:Europe

Posted 07 October 2009 - 09:20 PM

Here's a doctor who's taking TA-65 and who has published his test results.

I'm not a doctor, but from what I can see I'm not impressed. What do you folks think?:

http://www.rechargeb.../myresults.html

Is this guy selling TA-65 treatments? Has TA Sciences morphed into some sort of MLM scheme now? His results look a little shaky from the objective measurements, but he seems convinced that it helped him. Looks like he's selling it, though. It sounds to me like no one can measure telomere length accurately enough to show a real change over less than a multi-year timespan, at this point.


I would say that with regards to telomere lengths, his results show a very strong "I have no numbers to prove any claims of the effect of TA-65 in any direction what so ever".

This text is taken from the same website:
At birth, the average human telomere length is 11,000 base pairs. At 20 years, the average is 8,000. By age 50, around 7,000 remain. And so it goes, losing 50-100 base pairs a year until only 4000 remain at age 100.

According to his own text, a normal persons telomere lengths should drop with an average 50-100 base pairs each year. I wonder how he explains that the only two telomere values he measured during the year dropped with 600 and 300 base pairs respectively.

The picture he shows (albeit not with his own values) seem to be from the Canadian lab, so I assume the numbers he present in the table is his Median telomere length and not his Average telomere length - so of course the numbers may not be directly comparable.

Also, the Canadian lab say they have an accuracy of "well within .5kb difference" on blood from the same collection of blood, which makes his "changes" to mostly fall within the error margin of the test. So the only thing these numbers seem to prove is that the telomeres of his leukocytes has decreased somewhat in length.

Edited by GreenPower, 07 October 2009 - 09:21 PM.


#527 numbered

  • Guest, F@H
  • 81 posts
  • 6 ₮
  • Location:home

Posted 08 October 2009 - 06:13 AM

http://www.rechargeb...elomeres_v2.pdf

#528 MikeO

  • Guest
  • 5 posts
  • 1 ₮

Posted 08 October 2009 - 04:16 PM

On thinking about it, I've realized that while Dr. Park's personal results may appear to be poor, due to large error margins in the measurements if nothing else, TA Sciences probably has numbers for the aggregate results for 50-100 people, where the random errors in the measurements would be way reduced and the true trends would be visible. *Those* numbers are the ones I'd really like to see!

#529 tunt01

  • Guest
  • 2,308 posts
  • 414 ₮
  • Location:NW

Posted 08 October 2009 - 05:51 PM

On thinking about it, I've realized that while Dr. Park's personal results may appear to be poor, due to large error margins in the measurements if nothing else, TA Sciences probably has numbers for the aggregate results for 50-100 people, where the random errors in the measurements would be way reduced and the true trends would be visible. *Those* numbers are the ones I'd really like to see!


i had the same thought. his #s sucked, but it's one datapoint in isolation.

#530 taurus

  • Guest
  • 3 posts
  • 0 ₮

Posted 09 October 2009 - 12:02 AM

So if telomere shortening causes cells to senescence at about 5000 bp what is the health of cells with e.g. 7000 bp versus cells with 10000bp at birth? i.e. are cells that haven't yet reached the 5000 bp threshold, but are maybe at 7000bp...are they becoming less functional than they were when they had 10000bp? I'm curious what are the assumed benefits to boosting one's cell's telomere bps if none of the cells are close to senescence.

Edited by taurus, 09 October 2009 - 12:09 AM.


#531 newshadow

  • Guest
  • 28 posts
  • 0 ₮

Posted 09 October 2009 - 10:44 PM

Here is another one you probably knew about:

Accumulation of cells with short telomeres is associated with impaired zinc homeostasis and inflammation in old hypertensive participants.

Critical shortening of telomeres, likely associated with a considerable increase of senescent cells, can be observed in PBMC of individuals aged 80 and older. We investigated the relationship between critical telomere shortening and zinc status in healthy or hypertensive participants with or without cardiovascular disease in old and very old participants. Telomere shortening and accumulation of cells with short telomeres (percent of cells with short telomeres) in advancing age was evident in patients and healthy controls, but exacerbated in those patients aged 80 and older. Moreover, in very old patients, the accumulation of % CST may impair intracellular zinc homeostasis and metallothioneins expression, which itself is linked to an increased number of inflammatory agents, thereby suggesting the existence of a possible causal relationship between % CST and zinc homeostasis. The determination of % CST could be a more reliable means than the simple measure of telomere length as fundamental parameter in ageing to determine whether individuals are still able to respond to stress.


Yes... cellular Zinc nutrition...

Cheers
A



First,since no one has done this so far as I can see I would like to thank [you] Anthony for making these supplements available to us.I purchase many difficult to obtain supplements and if not for you I would have to deal with some pssibly shady Chinese suppliers.Second,you are correct about including Zinc and Folic acid.They are essential based on my research.I would add to the menu Ntbha,B12,and Aminoguanidine.

#532 newshadow

  • Guest
  • 28 posts
  • 0 ₮

Posted 09 October 2009 - 10:50 PM

Can someone provide a real scientific answer to why Astragalus supplementation wouldn't lead to cancer? Anthony said a couple of things in the thread specifically about this but it wasn't very scientific.


Some studies indicate that Telomerase combats cancer.Telomerase is not even present in [all] cancers.Many things need to happen before a cancer cell is ready for prime time.If you are concerned about cancer alternate with Melatonin,Curcumin,Aminoguanidine and Resveratrol.They all kill cancers dead.
  • Enjoying the show x 1

#533 newshadow

  • Guest
  • 28 posts
  • 0 ₮

Posted 09 October 2009 - 10:59 PM

So if telomere shortening causes cells to senescence at about 5000 bp what is the health of cells with e.g. 7000 bp versus cells with 10000bp at birth? i.e. are cells that haven't yet reached the 5000 bp threshold, but are maybe at 7000bp...are they becoming less functional than they were when they had 10000bp? I'm curious what are the assumed benefits to boosting one's cell's telomere bps if none of the cells are close to senescence.


As the telomeres get shorter the chromosomes are more like to fuse.This is very bad.That cell may need ''to go''.You do not need to have long telomeres to be immortal.You do not want short ones.In times of stress like for example free radical stress [which shortens telomeres] you want long ones.You are constantly under stress so you want to [keep] them as long as possible.

#534 AgeVivo

  • Guest, Engineer
  • 2,127 posts
  • 1,555 ₮

Posted 10 October 2009 - 10:23 AM

This thread constantly mixes sound scientific results and commercial arguments. I'd personnally be (more) enclined with telomerase activation compounds if it extended the lifespan of mammals (to avoid useless studies i should add: non short-lived, and peer-reviewed publication). It would be a *much* more convincing starting point.

Edited by AgeVivo, 10 October 2009 - 10:24 AM.


#535 VespeneGas

  • Guest
  • 600 posts
  • 34 ₮
  • Location:Oregon, atm

Posted 11 October 2009 - 06:06 PM

This thread constantly mixes sound scientific results and commercial arguments. I'd personnally be (more) enclined with telomerase activation compounds if it extended the lifespan of mammals (to avoid useless studies i should add: non short-lived, and peer-reviewed publication). It would be a *much* more convincing starting point.


I'm sure that all of us would love to see such studies. However, to my knowledge, no supplemental intervention has ever convincingly demonstrated an extension in maximum lifespan in normal, healthy members of a mammalian species.

Retarding the shortening of telomeres would only be one arm in a comprehensive anti-aging regimen. Reversal of mitochondrial dysfunction, maintenance of youthful rates of autophagy and DNA repair, chemoprevention, prevention/reversal of lipofuscin accumulation,... it seems unrealistic to expect any one chemical to extend lifespan in mammals.

#536 Suzudo

  • Guest
  • 35 posts
  • 1 ₮

Posted 12 October 2009 - 12:54 PM

I apologize in advance for the bad English.


First of all I invite you to information http://www.cnio.es/es/index.asp and especially the work of Maria Blasco and if they could contact her if they wanted to help could be relevant because is an eminence in relation to telomeres, telomerase and its relationship to cancer. It handles very substantial information regarding what is discussed on this blog.

http://www.tascience...2008Article.pdf
http://www.cnio.es/e...-18feb08-es.pdf
http://www.cnio.es/e...b-nota-0705.pdf



The astragalus Zahlbruckneri-Hand-Mazz of Turkish origin (Turkey) Astragaliside IV contains in its root (of a specimen of this variety and provenance astragaliside IV was obtained in an investigation of gastric protection capacity of that molecule-inter-) The The research did Jesus Arrieta Valencia for his doctorate in "doctor in medicine research" presented at the national polytechnic institute in research and graduate secretary in Mexico City





In the database: Comparative Toxicogenomics Database, for cycloastragenol is the following entry:

http://ctd.mdibl.org...hem&acc=C061014


The image is of saponin known in this group but provides information that I find interesting:

Name: cycloastragenol

CAS Type 1 Name: 9.19-Cyclolanostane-3 ,6,16,25-tetrol, 20.24-epoxy-, (3beta, 6alpha, 16beta, 24R) --

CAS Registry Number: 84605-18-5

And

Equivalent Terms: astramembrangenin; cyclogalegigenin


The term cyclogalegigenin:

http://direct.bl.uk/...om=searchengine

http://www.springerl...5862tm87240k6l/


Astragalus is very interesting caucasicus of Georgia and therefore contact with the people who wrote the article.



Other stuff:

In another entry in this blog has appointed these articles interesting:

Khavinson VKH, Bondarev IE, Butyugov AA. Khavinson VKH, Bondarev IE, Butyugov AA.
Epithalon peptide induces telomerase activity and telomere elongation in human somatic cells. E
Bull Exp Biol Med Bull Exp Biol Med 2003 Jun; 135 (6) :590-2.

Khavinson VKH, Bondarev IE, Butyugov AA, Smirnova TD. Khavinson VKH, Bondarev IE, Butyugov AA, Smirnova TD.
Peptide promotes overcoming of the division limit in human somatic cell.
Bull Exp Biol Med Bull Exp Biol Med 2004 May; 137 (5) :503-6.

Anisimov VN, Popovich IG, Zabezhinski? MA, Rozenfel'd SV, Khavinson VKH, Semenchenko AV Iashin AI. Anisimov VN, Popovich IG, Zabezhinski? MA, Rozenfel'd SV, Khavinson VKH, Semenchenko AV Iashin IA.
[Effect of epitalon and melatonin on life span and spontaneous carcinogenesis in senescence accelerated mice (SAM)]
Vopr Onkol. Vopr Onkol. 2005, 51 (1) :93-8

Melatonin is secreted in many areas of the body outside the pineal gland (trant gastrointestinal immune system, cutaneous, harderiana gland, retina, cerebero, epithelium, respiratory system, liver, kidney, adrenal gland, thyroid, pancreas, ovary, placenta , endometrium, carotid body, mast cells, NK cells, eosinophils, leukocytes, platelets, endothelial cells, Purkinje cells, hypothalamus and cell lines: Jurkat, U937, 3T3, BCG1, NB41A3, F9, MDCK)

In the pineal gland tryptophan hydroxylase with troptofano give 5-Hydroxytryptophan Decarboxylase copn of anina that would aromatic serotonin (a neutrotrasmisor of many hallucinogens like structure but not the same and would be responsible for improving the input to the brain and mental activity in full physical conscious) Arilalquilanina ester with N-N-acetilransferasa would acetilserotonina and with this e Hydroxyindole-O-methyltransferase melatonin would occur epithelial epitelion related.


Melatonin seems to be oncostátic, cronobiotic, inmunoregulator, antioxidant regulaciora of sexual maturation and anti-aging: It has been supplied in adult rodent melatonin and its life is prolonged by 10% to 15% more (eliminating the shortening in pineal gland a similar proportion of half life) thus pineal melatonin, as suggested by these articles could be behind the formation of epitelion (Ala-Glu-Asp-Gly) and the oligopeptide (first synthesized in the St. Petersburg Institute of bioregulation and Gerontology.) would be the natural activator of telomerase (but only extends the life a small percentage with natural processes)

The root of Rhodiola Rosea plant (or Russian Rhodiola) located in areas far north in Europe and Asia includes among its Componenet one called rosavin

http://www.anti-agin...diolaRosea.html

Rosavin molecule is a precursor of serotonin, without being an introduction or a hallucinogen serotonin in the body allows for greater availability of serotonin and thus improve mental activity, attention, and stimulates the activity and allow other in theory that the pineal gland synthesize more melatonin during sleep (hours sleep every night would be appropriate, therefore, extremely important)
Could it be that yes or no. But a test with flies that were fed the roots of Rhodiola rosea living a meda showed a 10% increase. Which tallies with the supply of melatonin and its relationship to epitelion

So it seems more than likely making rosavin or infusions of Rhodiola rosea along with a calendar of adequate sleep (at night-epithelial gland is photosensitive and responds to stimuli of light or darkness to ue serotonin or melatonin occurs days or night target species as an owl light produces melatonin unlike humans, for example-and at least 8 hours every day) would make any more epitelion available in the body.

The rosavin increases blood pressure (unlike the lower astragalisodos) therefore could be combined properly to avoid causing undesirable changes in blood or adjust to each person as if you have hypertension or hypotension (intend to calculate the appropriate amount that to counteract to that effect).


Explain because I rolled in this point as though nothing else release him before

Telomerase contains the length you should have no telomere shortening when activated but only got a bit longer than the total amount

Which is very convenient in case of suicide replicative cells with apoptosis, by stopping the activation of telomerase to continue copying again shortened telomeres and killing the harmful cells without ever becoming cancer and when not in restoring and activating telomere telomerase regularly before harmful cells die from lack of telomere-so it is very necessary to calculate the dose of activator and the time between shots as you take the dose as an inhibitor or reverastrol epigallocatechin-3-gallate from tea avoiding the coupling of telomerase and be more like Controlled Substances, or if you can have problems, but not as a rule, as its regular intake after taking telomerase activators, simply would drastically reduce the doses of these activators (no point increasing the dosage of chitosan add astragaloside IV or if after a short time he takes an inhibitor of telomerase action unless the dose is too high or become too straight shots. Another thing is the day to shoot these inhibitors after a activators making correct doses and times to let it end up killing themselves have entered the cells into apoptosis replicative harmlessly)


What are a little longer and not the total amount is very interesting. When the gene is activated telomerase tert forms a protein called T1 and you do not know too well how it works

Based on the current telomeres form a microRNA called something like tel-RNA that mark precisely the length and create a limit of what can be repaired (by ensuring cellular aging long-term yet temporary current lengthening securely against the possibility of a cancer)

The action of telomerase and how to repair as the tel-arn and other species is controlled by a small routine set in a micro RNA: the "miR-290" only present in placental mammals. The destruction of this microRNA causes an excessive production of telomerase bringing it directly to a cancerous tumor. This makes controls microRNAs as Rbl2 silence the gene family of retinoblastoma. The Rbl2 is a gene that repeated activation is responsible for excessive lengthening of telomeres and telomerase act without control. Rbl2 gene inhibits the enzymes Dnmt1, Dnmt3a and DNMT3B.

This seems important because in the miR-290 would be to control the process does not leave the safety limits

The oligopeptide epitelion (naturally present) would give the order to activate telomerase and miR-290 would control that became more or less attention to that more or less active order. In turn, the tel-RNA with these controls allow only one unit longer shop at the time of activation and not reinstate the full length.

I personally think that would make that request cycloastagenol activation was most consistently attended allowing lengthening over time rather than making his regular shortening and that would explain that with the TA-64 and just as regularly making some people are elongate six months in both the telomeres and others so little.

So I propose to combine well cycloastragenol or its derivatives hydrolyzable this (as astragaloside IV and others) and chitosan with rosavin or extract or infusion or whatever the root of Rhodiola rosea.


I still have more.
Tea has many antioxidants but contains an inhibitor of telomerase activity (making it more anti-cancer but their abuse could be counterproductive, however contains teine or caffeine - the same molecule is that of coffee) In contrast Rooibos does not contain this molecule in addition to a variety of antioxidants including Rooibos contains Super Oxide Dismutase, this molecule destroys the reactive forms of oxygen called superoxide also sometimes issued in the mitochondria for energy and activity that cause nuclear DNA damage causes entheogens rather than exogenous. The activity of mitochondria is to get energy and if abused the food is causing more of the superoxides but also to consume with exercise although it is very healthy and lower the total proportion of antioxidants. It would therefore be desirable to attach this form of "tea" but not "tea" per se as an infusion fluid in taking telomerase activators. It also has anticancer properties as the contribution of antioxidants and could be quite adequate.

And I think it would be appropriate because precisely suggest the root extract of Rhodiola rosea or supplement rosavin directly instead of melatonin (which can be invoked as a separate food supplement) to have more serotonin available and help increase the physical and mental activity .



So far the substances comment one is Asian or European origin, one from northern Russia, other African and other marine ...



The production of telomerase is not the only form of immortalization of cancers, another is the removal of undesirable elements called autophagy that keep the cell in good condition and would be undesirable forms in addition to the cause of some cancers also of the endometriosis (a disease of the female endometrium). And, as this would be the basis of maintaining nerve cells in good condition, avoiding diseases such as Alzheimer's (where wastes accumulate to disable neurons). It was recently announced in Nature that a molecule associated with maturation, reproductive cycles and the immune system known as spermidine cells would eliminate their waste and remain healthy long (something like instead of using antioxidants to protect nuclear DNA make them clean the cell to avoid that sort of damage that could force the deleting) but as in the activation of telomerase using spermidine appears that could cause damage and other types of cancer are not based on maintenance of telomere length. Therefore it takes much to be usable, I think.

It seems that a compound used as fabric dye for observation and as a tracer in an operation (which is poisonous in high doses) at doses of 60mg slows the accumulation and damage to the neurons in the case of Alzheimer's, destroying the links tau proteins garbage ...

I refer to

Metiltioninio or Cloruro of Phenothiazine-5-ium, 3,7-bis (dimethylamino) -, chloride, commonly known as methylene blue C16H18ClN3S.xH2O M. = 319.85 + H2O CAS: 61-73-4 EC: 200 -- 515-2

That if you take a little blue urine ... (has been used for jokes)

Anyway, it seems to originate new neurons in the brain in the cerebral cortex and encouraged its production with exercise with antidepressants and with the consumption of "blueberries" or at least this has happened in mice. But these new neurons are automatically destroyed after two weeks of training needed to maintain intellectual activity than usual or very high during most of the time.

So that part could be your solution



And then there's another cause of tissue damage over time yet.

A damaged tissue in mammals is populated not lack the same tissue but from a poorly differentiated called scar tissue. Words that makes you see a scar where the damage is external but also internal causes this tissue to repair both physical damage as bruises and other damage caused by various diseases. This fabric is of poor quality, like when telomeres are shortened there are fewer cells available to form the tissue in the other case is filled with pieces of fabric wrong and when large enough quantity also cause the same problems as the tissue aged.

Not all living things make up this tissue and everywhere. And it seems to have a relationship with telomere and telomerase curious.

A whale has generated less telomerase and telomeres shorter than a salamander instead live much longer. That seems a contradiction that is being discussed.

If a salamander was axelote or make a cut heal like us but, if a limb is regenerated back to mammals which we passed. Except in the liver.

According to Ken Muneoka, Majong Han and David M. Garnier seems that both we and the wound healed but oxelote in oxelote if the nerve regenerates through amputee member (with an injury and managed to move a nerve that would grow an extra leg to one and salamanders)


Human epidermis in adipose tissue, muscle, bone, nerve and vascular tissue regenerate after a minor injury but does not have that capacity to regenerate the dermis (and when there is a deep cut is damaged) the dermis has many types of cells and some of them are fibroblasts, these are primarily active in the regeneación members of a salamander, however, in humans (in mammals but it) does not do that but are scars, scar tissue, poor tissue regeneration ending with him and any is how and where damaged organs causing problems in the long run when more there.

When there is damage to the immune cells come to the place they turn emit signals that dermal fibroblasts surrounding tissue fibroblasts. Fibroblasts are an "extracellular matrix" is growing and hybridizing aberrant scar tissue forming and a salamander fibroblasts stop producing matrix when they occupy an area to move to a next phase. However, in the epithelium of a mammalian fetal wounds heal without scarring. So whatever they seem to be genes that are turned off after or changing in any way but we can share at least in part because it does not regenerate in the entire limb maimed and several genes that appear to regenerate limbs are activated in the embryo as Fgf8 and Wnt7a but in the differentiation of the ectoderm are disabled and curiously in salamanders epidermmicas cells produce wound that Fgf8 and Wnt7a are genes that perform functions in embryonic development as a temporary dedifferentiation. In the salamander the next stage is the formation of what she called a blastema in these genes are activated Fgf8 and Wnt7a and enters a state similar to embryonic development but as an adult member and regenerating the fibroblasts seem to have a kind of salamander of memory space coordinate system of the embryonic stage to regenerate the member correctly, but it turns out that according to Howard Y. Chang and John L. Stanford Rinn adult human fibroblasts also have that memory instead of simply passing the phase of blastema and continue and continue as in the salamander the process stops without the activation of these genes. Ken Muneoka, Majong Han and David M. Garnier have found a natural blastema in amputated wound and create a mouse but still no experimental confirmation that when it comes to the stage of blastema blastema provides the same signals that inhibit fibrosis in the wound. They feel safe to think that they can regenerate a limb or an organ, and believe that maybe in ten years can be.

It has had the idea that if certain parts of the adult body, the process works and the liver or elsewhere may occur around the chemical signals, proteins that inhibit fibrosis and permit the continuation of regeneration. There was a story in the media that I could not confirm its veracity in this Lee Mr Spievak an amputee had more than an inch of finger and would have such powders for four weeks delivered by his brother who work in this area and was supposedly regenerated piece of finger amputee: nail, bones, muscles, everything and only correct that the notary as calloused skin and the nail grow faster


Here is the list of substances in extracellular matrix obtained for this purpose:

http://www.mirm.pitt...ojects.Host.asp


Obviously not the same one centimeter scar tissue in a whale than a centimeter on a stove (or a small animal). A small animal has to repair the wounds more effectively and that means many new copies of cells must therefore have much longer telomeres and / or generate more telomerase to avoid aging faster and even more if it is to regenerate the whole tissue to replace an entire limb.


In addition to live shorter half it is less relevant than the process eventually cause cancer and more likely than before to have problems with this will have died of old


The activation of genes in humans Member rebuild or use of substances containing the signals for further differentiation is needed that would activate telomerase in a more abundant and controlled so that the tissue formed in addition to not scar is not old. And if you are a member, part of an organ piece, equal etc.. Lee said Mr Spievak seems that the piece of finger she grew up is different about consistency and so on.


More

Years ago I saw that he proposed a telomerase activator of several patents that were requested (actually a transactivator, which was found by searching for the cause of diseases in which telomerase is not activated ")

I refer to the nucleotide sequence of Sequence or associated peptides: dyskerin 24.2 of the GSE.

The total sequence dyskerin has 514 amino acids, but the GSE 24.2 is 55

Adding this by virus vectors, liposomes or other mechanisms (hydrolysis in the stomach destroys a very long sequence of ammonia and it is difficult to penetrate the cell membrane) appear to be active telomerase production about 140 days in a row


The total sequence is dyskerin


MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIK PESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNP LKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEK TGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGI VRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLR VRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLG LLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLY DNHKDESYLRR --- V --- VYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAK
IKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDKHGKPTDSTPATWKQEYVDYSESAKKEVVAEVVKAPQVVAEAAKTAK
RKRESESESDETPPAAPQLIKKEKKKSKKDKKAKAGLESGAEPGDGDSDTTKKKKKKKKAKEVELVSE


The amino acid that have separated - V - on purpose is that in its mutated form causes dyskeratosis congenita and telomerase is not active in the person suffering is crucial for both the GSE 24.2 sequence

The mutant is the dyskerin:


MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIK PESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNP LKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEK TGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGI VRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLR VRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLG LLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLY DNHKDESYLRR --- F --- VYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDH


Database seems to have found loose in the cells containing that amino acid fragment:

RVVYPLEK identified as Pap00425566

Arginine / Valine / Valine / tyrosine / Proline / Leucine / glutamic acid / lysine


After looking at items that make cancers grow capillaries of different size and quimitoterapia that works well on cancer cells in vitro does not work equally well in vivo because they simply do not get to have more narrow capillaries and the lack of oxygen were still favors these cancers (by having better autophagy can make better use of own resources and not require much input supply and also have to supply their products to the agency to serve) I thought a potent activator of telomerase (as derived from the dyskerin) could be safe if used a powerful anticancer but were both molecules within a liposome so that the cell to reach him telomerase activator sure that you come to the cancer.

Of anticancer seems that capsaicin, the molecule that makes spicy food spicy-activator is damage control by the micondrías but cause digestive problems and nerves are sensitive to it (there is a similarly named but is synthetic civamina )

Roche Laboratories have created an activator of the p53 gene (control by nuclear DNA) called nutlin. The best version is the molecule nutlin-3a, is a synthetic molecules and drugs called smart because it only works when certain elements are present in proteins that have not been damaged, which may cause malfunction P53 (nutlin-3: CAS 548,472 -- 68-0). Evidenemte is synthesis. That there is a molecule similar in nature or obtainable with changes ...

And another molecule (also synthetic) which orders cancer cell apoptosis (and little or not healthy) AZD-2281 is also called Olaparib

http://en.wikipedia.org/wiki/Olaparib


I have more information about this and hung on http://www.ecreencia...index.php/topic speculation, 403.0.html

Although in Castilian (ie in Spanish from Spain, I'm sorry, but if someone dominates, or use a good translator ...)



I hope you understand something and serve as useful.


Shilima khemen

#537 smithx

  • Guest
  • 1,456 posts
  • 462 ₮

Posted 14 October 2009 - 09:31 PM

What's up with the 92% decrease in "cognitive flexibility"?

Maybe whomever said that TA-65 causes cognitive problems wasn't far from the truth?

Here's a doctor who's taking TA-65 and who has published his test results.

I'm not a doctor, but from what I can see I'm not impressed. What do you folks think?:

http://www.rechargeb.../myresults.html

-- Mike



#538 smithx

  • Guest
  • 1,456 posts
  • 462 ₮

Posted 14 October 2009 - 09:45 PM

My argument went like this:

- Cancer increases when telomeres become shorter, because more errors in transcription occur and some of these mutations can cause cancer.

- Longer telomeres are protective because they decrease the number of errors, therefore should reduce cancer.

- This would probably only be true if the chromosomes in question were not already damaged.

- Therefore it would be safer to use telomerase activators if your telomeres are not already shortened enough that damage has already occurred.

- In this post http://www.imminst.o...mp;#entry291409 I reference a study which shows that significant telomere shortening appears to happen after age 55

- Therefore it might make sense to lengthen your telomeres if you are age 55 or below

This is very speculative, however, and I've discontinued A IV for now, after using it for about a year or more.

Anyone else have thoughts about this?

Can someone provide a real scientific answer to why Astragalus supplementation wouldn't lead to cancer? Anthony said a couple of things in the thread specifically about this but it wasn't very scientific.



#539 Sims

  • Guest
  • 2 posts
  • 0 ₮

Posted 17 October 2009 - 03:29 PM

Hello all - I'm new here, but have done a fair amount of reading and research on my own before posting. I have a very specific question regarding Astral Fruit/Astragaloside IV - has any further evidence (anecdotal or otherwise) surfaced that would suggest any consistency in terms of hair re-pigmentation? I know there were a few reports early on of older men getting some color back, but it seems that there has been little follow-up.

Thanks

#540 GreenPower

  • Guest
  • 201 posts
  • 69 ₮
  • Location:Europe

Posted 18 October 2009 - 06:55 AM

Hello all - I'm new here, but have done a fair amount of reading and research on my own before posting. I have a very specific question regarding Astral Fruit/Astragaloside IV - has any further evidence (anecdotal or otherwise) surfaced that would suggest any consistency in terms of hair re-pigmentation? I know there were a few reports early on of older men getting some color back, but it seems that there has been little follow-up.

Thanks


You might have read my experiences in another post, if not - I repeat them here.

>>I've just finished two periods of 3 months, with a three week interval in between. The first period was 3 x 33mg and the second was 1 x 100mg + Chitosan. The latter period also included the use of Orlistat (3x120mg) and Gingko Biloba (1x100mg).
>>The results with regards to hair growth was:
>>Period 1:
>>Whitish down in locations where hair growth had completely disappeared, guesstimated to be about 1-3 mm depending on location (see earlier post for more info: http://www.imminst.o...amp;pid=319855)
>>Period 2:
>>The white down has grown more pronounced and thicker. I would guess it's now about 2-5 mm depending on location. It has not shown any tendency to change color yet,
>>though. I think my hair grows somewhat faster than before, but this can be a subjective feeling rather than an objective observation.
>
>
>My hairline hadn't receded more than a few centimeters before I started with AIV, most of it before turning 20. Between then and now (38) it has remained constant. I would say that this whitish down corresponds to about every hair I've ever lost.
>But please note, it's "white down" and not yet real hair. Personally I've not used AIV in order to stimulate hairgrowth, but in order to try rejuvenating my immune system.
>If the down at some point turns into real hair, it's a bonus - but it's not the main purpose of me using AIV.

And with regards to rejuvenating the immune system, I recently got the results from my second "detailed procedure" from the canadian lab. They were not very good and I've now switched from AIV to Cycloastragenol. Therefore I will not be able to say whether I would have got any color back or not from a continued use of AIV.




5 user(s) are reading this topic

0 members, 5 guests, 0 anonymous users